USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
$0.00
Balmar Offshore Repair Kit 60 Series 12V w/Bearings, Brushes, Regulator/Rectifier

Balmar Offshore Repair Kit 60 Series 12V w/Bearings, Brushes, Regulator/Rectifier

$162.81 inc. tax

Offshore Repair Kit 60 Series 12V with Bearings, Brushes, Regulator/Rectifier

Offshore Repair Kit, 60 Series Alternators, 12V

Kit Includes:

  • Regulator
  • Brush Holder Assembly
  • Rear Bearing 
  • Regulator Washer 
  • Rectifier Assembly 
  • Rectifier Gasket 
  • Front Bearing 
  • Instruction Sheet
This product may not be returned to the original point of purchase. Please contact the manufacturer directly with any issues or concerns.
Product Code: 79878
Brand: Balmar
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i