USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
$0.00
Balmar Alternator 1-2" Single Foot K6 Serpentine Pulley - 170A - 12V

Balmar Alternator 1-2" Single Foot K6 Serpentine Pulley - 170A - 12V

$883.93 inc. tax

Alternator 1-2" Single Foot K6 Serpentine Pulley - 170A - 12V

Balmar offers a wide range of alternator power upgrades designed specifically for marine industry applications. Balmar installs high reliability bearings, robust rectifier diodes and improved heat-sinking capabilities on all our alternators to ensure improved system reliability combined with increased charging power.

Features:

  • 1-2" Single Foot K6 Serpentine Pulley
  • 170A
  • 12V
This product may not be returned to the original point of purchase. Please contact the manufacturer directly with any issues or concerns.
Product Code: 74954
Brand: Balmar
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i