USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
$0.00
Standard Horizon Rubber Duck Antenna

Standard Horizon Rubber Duck Antenna

$13.98 inc. tax
Rubber duck antenna fits most handhelds except HX470/471.

Compatible with:
Current Models:
  • HX300
  • HX280S
  • HX290
  • HX370S
  • HX400
  • HX751
  • HX851

    • Previous Models:
  • HX270S
  • HX460
  • HX500S
  • HX600S
  • HX750S
  • HX760S
  • HX850S
    • Product Code: 25307
    Brand: Standard Horizon
    Product Condition: New
    Updating Order Details
    Please do not refresh or navigate away from the page!
    Product Added to your Cart
    x

    -------- OR --------

    Create a free online store
    Powered by freewebstore
    Get your free online store today - Be your own boss!
    freewebstore
    Got a great business idea?
    Get a free online store just like this one!
    What do I get?
    Full eCommerce store
    Free hosting
    Unlimited products
    Domain & Free SSL
    checkout
    24/7 support
    And more...
    Why freewebstore?
    20+ years
    1M+ stores created
    No payment required
    Easy to create
    What's the catch?
    Nope, no catch
    0% commission
    Free forever!
    Premium upgrades available
    Get Started
    i